SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338212888|ref|YP_004656943.1| from Runella slithyformis DSM 19594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338212888|ref|YP_004656943.1|
Domain Number 1 Region: 226-616
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.88e-80
Family beta-Lactamase/D-ala carboxypeptidase 0.00058
Further Details:      
 
Domain Number 2 Region: 57-166,198-273
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 4.84e-19
Family Penicillin binding protein dimerisation domain 0.0082
Further Details:      
 
Domain Number 3 Region: 682-724
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000235
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338212888|ref|YP_004656943.1|
Sequence length 731
Comment peptidoglycan glycosyltransferase [Runella slithyformis DSM 19594]
Sequence
MRGKTRNIRDDILQRSWVVAIGLIVLGALVIYRIFYIQHYAKYKGKPWIEYMSKTVRVDT
IPAMRGNIYSNDGSLMATSLPYFEVSIDPTVADSVYFYTRVDSLANLFASTFGQRTAESY
AKELRFARHEFERNEKRGNRNIRLLKRKVTYREYSIILGQEFKGKVKKKDGTQFDATWKG
WPFFRRFASTGRSRGGKLTITYERYNPFGSLAERTVGYLDKKTHRGLVGLEAGFEKRLAG
KPGVGLYRVLDDQTFMPNEDEEGLQPTNGYDLYTTIDINFQDIAETALRNTLRSYNADYG
CVIVMEVQTGEIRAIANLSHDTDSTYRETYNYALAGLGNPGSTFKLASMLAALEEGLSPK
RVYQTGNGVMTYKSAVIRDTKRTGHGALTAQQVFEKSSNVGVHLVMKDYFYSKPDKYVGY
LKRFHLREPTGILMKGEPDPRIRIPSDKRWSKTSLTYMSYGYESELTPLQMLSFYNAVAN
DGYWVRPMLVKQIRQADEVIQEMVPFKSEQRIAAESSLRKARAMLEGVVEHGTATHIKNP
YYKIAGKTGTAQKLVNGRYVPGLYNTSFIGYFPADAPRYSVLVVVDSPRGFSMEQLYAGS
VAVPVFKEVVDRIVGYDINMHPPIPKHQNKNSEMSRQLRAGHADDLRIVAEEMDIESPVN
VNGWVEAKKDKNGVKWENRDADPNKLPNLKGMTLRDALYLLENHGFKVAYTGQGKVAEYE
YKRGFYVLTLK
Download sequence
Identical sequences F8ELY6
gi|338212888|ref|YP_004656943.1| WP_013929115.1.37789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]