SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338213845|ref|YP_004657900.1| from Runella slithyformis DSM 19594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338213845|ref|YP_004657900.1|
Domain Number 1 Region: 6-136
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 7.06e-49
Family Molybdopterin synthase subunit MoaE 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338213845|ref|YP_004657900.1|
Sequence length 138
Comment molybdopterin biosynthesis protein MoaE [Runella slithyformis DSM 19594]
Sequence
MIDIQLLETTLSTQTCFDYVLSDEAGGIVTFVGTVRHQTKGKRVLRLEFEAYAPMAIREM
QKIAEEAMRRWPVLKISIHHRVGVLDIGEIPVIIAVACAHRNTAFEACQFAIDTLKETVP
IWKKEFFEDGEVWVAAHP
Download sequence
Identical sequences F8EI23
gi|338213845|ref|YP_004657900.1| WP_013930061.1.37789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]