SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338214951|ref|YP_004659016.1| from Runella slithyformis DSM 19594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338214951|ref|YP_004659016.1|
Domain Number 1 Region: 394-593
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.21e-28
Family ABC transporter ATPase domain-like 0.00079
Further Details:      
 
Domain Number 2 Region: 126-270
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000209
Family DNA repair protein MutS, domain III 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338214951|ref|YP_004659016.1|
Sequence length 595
Comment DNA mismatch repair protein MutS domain-containing protein [Runella slithyformis DSM 19594]
Sequence
MTPSDIFTKRQTEFTHQAEVFQRSYNQLSTVRLIIFVAAVFTVWQTLSFPIWIPLVSGIV
GLTLFAFILRRHQTTKRQWELHRALAALNTDEAERLSLRFARSATGAEFAVKNHVYCNDL
DIFGPHSLFRLLNRAHTRIGMQTLAEWLLSPADPIEISVRQDAIRELTPLLDWRQELEAN
ARLEKRIAEPTDFLERWLHAGENKAILRWKKLRLLPVLTISIIIGAFLGWIPWLTAVLFL
GFHSFILTKLNPSVKEYAEQSQGIVDTLKALGILLEKIEKHSFQSAKLQQLQYRLTSETG
AASKQIKVLASVTESLNFRLNPYFMLAIGLPSLWDLQWMTKLEAWKQTHRHNLAKWLAVV
GQMEALGSLAGFSYANPQYPFAEISPEVFQLKALKTGHPLIHPAKRVSNDFALNDIGQTA
VITGSNMSGKSTFLRTVGLNTVLALAGSPVCAEAFTCSPVRVFTSMRTQDSLEDNTSSFY
AELKRLEALLQLAQSSSIPVFYFLDEILKGTNSVDRHKGAEALIRQLHVLKSSGFVSTHD
LELGMMSIEHDYVHNYSFYSTFSDGQLHFDYHLQEGVCREFNATALMRQIGIEIN
Download sequence
Identical sequences F8ELB5
gi|338214951|ref|YP_004659016.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]