SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338212077|ref|YP_004656132.1| from Runella slithyformis DSM 19594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338212077|ref|YP_004656132.1|
Domain Number 1 Region: 15-198
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.14e-48
Family Methylesterase CheB, C-terminal domain 0.00022
Further Details:      
 
Domain Number 2 Region: 284-478
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.8e-44
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1063-1240
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.51e-33
Family Histidine kinase 0.0035
Further Details:      
 
Domain Number 4 Region: 845-968
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.64e-26
Family Heme-binding PAS domain 0.061
Further Details:      
 
Domain Number 5 Region: 991-1070
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.51e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0037
Further Details:      
 
Domain Number 6 Region: 217-286
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000562
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0074
Further Details:      
 
Domain Number 7 Region: 744-858
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000262
Family Heme-binding PAS domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338212077|ref|YP_004656132.1|
Sequence length 1251
Comment signal transduction histidine kinase with CheB and CheR activity [Runella slithyformis DSM 19594]
Sequence
MANKTASPSEGEKENVPIVAIGASAGGLDAVSELLRHLSPTTNMCYVYVQHPDPSQDNRL
SAVLSKVTQMTVRDAEYEMPLRPNEVYVIPPDKDMEIIDGLLVHRPRNEETFMHMPIDRF
FVSLSERQREGAIALLLSGMGTDGTLGLKAVKMSGGITFAQDETARFRSMPMAAIGEGVV
DMVMSPEDMAREIGRLSQKATVFLRVKEDGSGNEEDADTDLRIILQLLLKATGVDFSHYK
INTIQRRINRRIVLYRLESLRDYAKYLREHPLEVGILYNDLLINVTQFFRDQETVSYLQK
VILPQIIHIKPAQEPIRIWVPACATGEEAYSLAMLLMEVFEELSISRPIQIFATDLSEIA
IAKARLGTYTQSELLGVSPKRLQRFFTKADDQYRIIRHIRDVCVFAPHNLFKDPPFSRLD
LISCCNLFIYLDTTLQKQAISIFHYALNAAGFLQLGKSETIGGAGAIFAQVEKSVKIYVR
KNDTAVLPSLQINSRSRESDRTGSSSRRGFTLKETVFNSNELDKEVDALLLAQYVPASVV
VNQDLDILQFRGSTGLFLEPSPGKASLNLLKMARPDLVFELRSLVHKVKKTGKTAHKTGL
ELNVKGNVHQVEVEALPLRNEAAERLILIVFREIPLTDVSLRPSVARDRRIRQLEEELAL
AREDMRSIIEDQEANNEELQSANEEIVSSNEELQSINEELETSKEEIESTNEELITINQE
LQLRNDQLSEAQEYANVIFGTIREATLMLDRSLRVRSANVAFYKTFHARAEETEGRLIYE
LDERQWDIPELRHLLENIIPYKGHFQGFEVRHTFPGVGEKIMMLNAKMVMQQPNRQEMIL
LVIEDITEHRQVQRLLEEREAWFHGMADNAPVLIRVAGTDGLYNFFNKTWLEFTGRTMEE
ETGHGWTQRIQPDDRECYQQLYDEHFHSRQPYRTEYRLMRHDGAYRWMLENGKPLFSIDG
EFIGYMGTCAEVHDQKMENEVLEAKVKQRTQDLYEANANLKRSNEELRQYAYIASHDLQE
PLRKIVTFSGRIQKKFAESLPEQGHEYLAKIVTSAQRMTRLIDDLLTFSRTIHQNKNFVT
VDLNEVLRGVLQDFDLTISEKNAAVRAAHLPTIEAVPLQMAQLFYNLVGNALKFTSGSKP
PLISIEAKEATVEEVHHHISQAAPGVYWKISVRDNGIGFDPAYSEQIFSIFQRLHDRDTY
MGTGIGLALCRRIINNHDGDLYAEGKEGEGAIFHLLLPAKQSQTERKFSES
Download sequence
Identical sequences F8EFW4
gi|338212077|ref|YP_004656132.1| WP_013928309.1.37789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]