SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338213731|ref|YP_004657786.1| from Runella slithyformis DSM 19594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338213731|ref|YP_004657786.1|
Domain Number 1 Region: 9-242
Classification Level Classification E-value
Superfamily SIS domain 2.78e-67
Family mono-SIS domain 0.000000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338213731|ref|YP_004657786.1|
Sequence length 272
Comment N-acetylmuramic acid 6-phosphate etherase [Runella slithyformis DSM 19594]
Sequence
MLSTSTTESASRYDHLDQMSVRELLININNEDKTVPYAVEKAIPQIEALVEQIVVRMKQG
GRLFYIGAGTSGRLGVVDASECPPTYGVPFDLVIGLMAGGDKAIRRAVENAEDDPEQAWI
DLKEYEIDELDSLVGIAASGRTPYVIGGLQKARESGILTGCIVCNTGSAVAAAAEYPVEI
VVGPEFVTGSTRMKSGTAQKLALNMISTSVMIQLGRVKGNKMVDMQMTNYKLVQRAIRMV
KEELPHLTNEEAQTLLDAHGSVRNAIEAGRKV
Download sequence
Identical sequences F8ENS8
WP_013929950.1.37789 gi|338213731|ref|YP_004657786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]