SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338215119|ref|YP_004659108.1| from Runella slithyformis DSM 19594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338215119|ref|YP_004659108.1|
Domain Number 1 Region: 359-379,418-654
Classification Level Classification E-value
Superfamily HAD-like 2.78e-51
Family Meta-cation ATPase, catalytic domain P 0.00087
Further Details:      
 
Domain Number 2 Region: 162-259
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.35e-20
Family Calcium ATPase, transduction domain A 0.0088
Further Details:      
 
Domain Number 3 Region: 100-163,260-355
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000017
Family Calcium ATPase, transmembrane domain M 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338215119|ref|YP_004659108.1|
Sequence length 662
Comment heavy metal translocating P-type ATPase [Runella slithyformis DSM 19594]
Sequence
MEKKVQKHKNYITDDCCDKPIEVQMPKHSDNDGHDHEEESGEESLLKSRWRLWLSLTILL
GFVAITQLFKVEVSKPIEIGLMGIAYLLAGYNTLERAFRSLRRGDFFNEFTLMSIATLGA
FYIGEYSEGVAVMIFYEIGELFQDLAVNRSKRSIKALLDVRPDTVTVLRNGKQQSVGPSE
VQIGESILVKPGEKVALDSTLLTDNASFNTAALTGESRPDTKRTGEAVLAGMINLDKVIE
LKVTTAFKDSKLSRILEMVQDATARKAPTQLLITRLAKIYTPIVFGLALAITLIPYFFAN
DYSFNEWLYRGMVFLVIACPCALTVSIPLGYFGGIGLASRNGILVKGSNFLDVMTELNTI
VSDKTGTLTKGVFKVQTVETKSDVALFIQIAAALESASTHPVAKALVEYANIQKTNWQDL
VVEAVEEISGHGLKGVVNGKTVLAGNLKLLQKFNVSYPAELAQIVETVVVVAIDNHYAGH
ITIADEVKDDAAQTVVDLKALGIETIMLSGDKSAVVQQVAQKLGISNAYGDLLPEGKVEK
VQELKNQDKKIAFVGDGVNDAPVVALADAGIAMGGMGSDATIETADIVIQNDQPHKIVSA
IKIGKITKSVVWQNISLAMGVKVAVMLLGAGGIATLWEAVFADVGVALLAILNAYRIQRK
QL
Download sequence
Identical sequences F8ER19
gi|338215119|ref|YP_004659108.1|NC_015704 gi|338215119|ref|YP_004659108.1| WP_013931242.1.37789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]