SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222109410|ref|YP_002551674.1| from Acidovorax ebreus TPSY

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222109410|ref|YP_002551674.1|
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000000000000199
Family Rob transcription factor, C-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222109410|ref|YP_002551674.1|
Sequence length 156
Comment transcription activator effector-binding [Acidovorax ebreus TPSY]
Sequence
MTPITVQVPAFSVAGVAVRTCNRDEAQPERARIGALWDQFFTESWARQLPGPGADGRLYG
VYSAYESDQHGAFDVTAGVSAAVQADPPVGAARIEVQPGSYLVFHCEGPMPQMVLDAWAA
AWRYFEEHPEVRRRFDTDFECYEGPECVALHIGVLL
Download sequence
Identical sequences B9MAM7
535289.Dtpsy_0189 WP_012655292.1.47842 WP_012655292.1.80021 gi|222109410|ref|YP_002551674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]