SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|402559650|ref|YP_006602374.1| from Bacillus thuringiensis HD-771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402559650|ref|YP_006602374.1|
Domain Number 1 Region: 84-242
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 5.62e-47
Family PA2201 C-terminal domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|402559650|ref|YP_006602374.1|
Sequence length 243
Comment hypothetical protein BTG_04220 [Bacillus thuringiensis HD-771]
Sequence
MLRDKIKNDIYFNKFINYEEKRIEKFLLLVEKVIEERGKDDKGVKNGYIALQGYHFNKLR
AMYSAGCSIQTIRDFLPEVINIMEKVWNKESGYIRMLWIISIAVMLNVEDKEFNRLIAMV
RKEGLNDYLINYFIAFRNSEPSDFYEQSEFYVKYPYFKLKEVIESNKISQENSIKNLEKY
IKEYWYKGHLEEAWYDAHENKHDIYSGYWSFESGAIAKILKLDDSTLKDSSYYPYDMVHC
QEK
Download sequence
Identical sequences C3DWT6 J3UK43 J7WPY3 R8RYK9 R8XDX3
WP_000942843.1.27446 WP_000942843.1.34537 WP_000942843.1.59384 WP_000942843.1.70667 gi|402559650|ref|YP_006602374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]