SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|402559735|ref|YP_006602459.1| from Bacillus thuringiensis HD-771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402559735|ref|YP_006602459.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.19e-73
Family EF1021-like 0.0000223
Further Details:      
 
Domain Number 2 Region: 281-386
Classification Level Classification E-value
Superfamily SCP-like 1.22e-25
Family EF1021 C-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|402559735|ref|YP_006602459.1|
Sequence length 386
Comment GNAT family acetyltransferase [Bacillus thuringiensis HD-771]
Sequence
MNVIQLKEDKFREALRLSEYAFQYKVDEERLQQQLTKMKESHKIYGIMEGEDLAAKLHLI
PFHIYIGKEKFKMGGVAGVATYPEYRRSGYVKELLQYSLQTMKKDGYTVSMLHPFAVSFY
RKYGWELCANLVTCHMTKSDLVMKKQVNGTVKRFNKENHPEEVEKLYEVFAERFSGMLVR
EKNWWLQAVYDDLTLAIYYDENKKAAGYMLYKIENYKMTVEEFVPLHNEARNGLWNFICQ
HDSMIKELEMTVSENEPLLYSLQEPRVKTEIKPYFMGRIVDVEQFLKQYELSWNNVQQEV
ILHITDAFAPWNNVSVRLANHEITIMKEETIDKGIKLDINALSTITFGYKRPLELNELEF
ISGSEEEIQAFENIVPVRKAFIYDFF
Download sequence
Identical sequences J3UK99
gi|402559735|ref|YP_006602459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]