SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|402560391|ref|YP_006603115.1| from Bacillus thuringiensis HD-771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402560391|ref|YP_006603115.1|
Domain Number 1 Region: 14-276
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.71e-35
Family EF1021-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|402560391|ref|YP_006603115.1|
Sequence length 294
Comment hypothetical protein BTG_08030 [Bacillus thuringiensis HD-771]
Sequence
MGNVEKMASLLIEEPKREQLFPLFEEVFEITTQTLNDFSDKGYWDDTYKALSFLQEDKVI
ANVAAFSLPLLINGEKINAAGIQSVMTHPNFRRQGLMKQLMGKMIEEIDKKCECTLLFTE
KPELYTAFGFKVVQEYLMTIPYDKNNNNDSLLKKLDYYNVENRQLIHETIDSGQRLSNNF
STLNFRPSFYLNMYDSEWNEKLYYSEKLDALIVYEVDNEKLKLFGVFAPVLPVLDEICGE
INERFTEIEFYFSPDQLGIEDVQFTELQSSKYLMVRSDKELDFKGYKFPVLAEF
Download sequence
Identical sequences A0A1H6U8N1 A0A243AMY3 A0A2B9DP52 A0A2H3QQR8 B7IWB6 J3WWT4 J7TDP8 R8C8P2 R8ILU6 R8S193 R8Y4B0
WP_000528682.1.100497 WP_000528682.1.12935 WP_000528682.1.13269 WP_000528682.1.22084 WP_000528682.1.27446 WP_000528682.1.28599 WP_000528682.1.34537 WP_000528682.1.4355 WP_000528682.1.50042 WP_000528682.1.58712 WP_000528682.1.59384 WP_000528682.1.61799 WP_000528682.1.6241 WP_000528682.1.70667 WP_000528682.1.73638 WP_000528682.1.83666 WP_000528682.1.87649 WP_000528682.1.89145 WP_000528682.1.92555 WP_000528682.1.9703 WP_000528682.1.97821 WP_000528682.1.98315 405531.BCG9842_B2935 gi|218897374|ref|YP_002445785.1| gi|402560391|ref|YP_006603115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]