SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|402560685|ref|YP_006603409.1| from Bacillus thuringiensis HD-771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402560685|ref|YP_006603409.1|
Domain Number 1 Region: 4-176
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.92e-38
Family N-acetyl transferase, NAT 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|402560685|ref|YP_006603409.1|
Sequence length 188
Comment acetyltransferase [Bacillus thuringiensis HD-771]
Sequence
MQNVVLKGKKVTIRTIEESDIKTLWNIIFKEESPEWKKWDAPYFPFSMQEYSSYKEKMQN
RLKEEPLSNLIIENNGQIIGTVGFYWEYKMTRWLEMGVVIYEPTYWNGGYGTEALKLYRD
LLFEKMEIGRVGITTWSGNERMMKVAEKIGMSLEGRMRKCRYYNGTYYDSIRMGMIREEW
EALCVTKG
Download sequence
Identical sequences A0A0Q9G365 A0A0Q9H9J7 A0A160L9L7 A0A242Y3L4 A0A243B8R3 A0A243LKQ7 A0A2B9DAY6 A0A2C1G551 J3UM11 J7VGM9 R8C603 R8IJ00 R8S4G1 R8YG49
gi|402560685|ref|YP_006603409.1| gi|434375046|ref|YP_006609690.1| WP_001181851.1.100497 WP_001181851.1.101838 WP_001181851.1.12935 WP_001181851.1.13269 WP_001181851.1.22084 WP_001181851.1.26459 WP_001181851.1.27446 WP_001181851.1.28599 WP_001181851.1.34537 WP_001181851.1.3546 WP_001181851.1.38325 WP_001181851.1.48759 WP_001181851.1.52284 WP_001181851.1.58712 WP_001181851.1.59384 WP_001181851.1.60526 WP_001181851.1.64421 WP_001181851.1.70667 WP_001181851.1.83666 WP_001181851.1.87705 WP_001181851.1.89145 WP_001181851.1.97821 WP_001181851.1.97830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]