SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|402564734|ref|YP_006607458.1| from Bacillus thuringiensis HD-771

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402564734|ref|YP_006607458.1|
Domain Number 1 Region: 33-145
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000881
Family N-acetyl transferase, NAT 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|402564734|ref|YP_006607458.1|
Sequence length 157
Comment hypothetical protein BTG_30160 [Bacillus thuringiensis HD-771]
Sequence
MGFPKVERLLINYKTLDEFKKFKGCGAQELSMLEELQANIIENDSESPFYGIYYGGSLIA
RMSLYMKRNGGEPFEITGPYLELYKLEVLPTFQKQGFGQMLVNHAKQMQFPIKTIARIHS
SGFWDKLSFNPVSVTDGDFYIWHPETNLNAVTNEESA
Download sequence
Identical sequences A0A1H6QE88 A0A243BFJ2 A0A243MA78 A0A2B9FAU9 A0A2H3QA29 B7IVF6 C3DNY1 J4A1Z8 J7VYJ2 J8G5P8 R8CEY9 R8ITN7 R8RRM5 R8YLJ0
WP_000506698.1.100497 WP_000506698.1.12935 WP_000506698.1.13269 WP_000506698.1.22084 WP_000506698.1.27446 WP_000506698.1.28599 WP_000506698.1.34537 WP_000506698.1.35769 WP_000506698.1.36279 WP_000506698.1.4355 WP_000506698.1.48759 WP_000506698.1.50042 WP_000506698.1.58712 WP_000506698.1.59384 WP_000506698.1.61799 WP_000506698.1.6241 WP_000506698.1.70667 WP_000506698.1.73638 WP_000506698.1.87649 WP_000506698.1.89145 WP_000506698.1.92555 WP_000506698.1.9703 WP_000506698.1.97821 WP_000506698.1.98315 gi|402564734|ref|YP_006607458.1| gi|218899075|ref|YP_002447486.1| 405531.BCG9842_B1219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]