SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222082323|ref|YP_002541688.1| from Agrobacterium radiobacter K84

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222082323|ref|YP_002541688.1|
Domain Number 1 Region: 12-255
Classification Level Classification E-value
Superfamily SIS domain 2.14e-74
Family mono-SIS domain 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222082323|ref|YP_002541688.1|
Sequence length 307
Comment N-acetylmuramic acid 6-phosphate etherase [Agrobacterium radiobacter K84]
Sequence
MTEQRLISELEQLVSEGRNPNTMHIDLLPTFDILREINYEDQTVPTAVEKVIPAIAAAVN
QIVAAFQKGGRLIYMGAGTSGRLGVLDASECPPTFSVPSDMVIGLIAGGPEALQNSIEGA
EDDPEQGRQALQDIKLTSTDVVVGIAVSGRTPYVIGGLNYAKSIGAVTIALSCNPNSIIA
GIADLAISPVVGPEILTGSTRLKSGTAQKLILNMLTTASMIRIGKSYQNLMVDVHASNKK
LVARAIRIVMQATGCTQADARRVLDQTGNDVKLAILMEITGMGIEEARAALQNAGGFLRK
AISAKTA
Download sequence
Identical sequences A0A061MS02 A0A071IPX1 B9JJJ9
WP_012650312.1.39766 WP_012650312.1.44225 WP_012650312.1.44284 WP_012650312.1.55147 WP_012650312.1.56352 WP_012650312.1.78634 WP_012650312.1.85071 WP_012650312.1.88216 WP_012650312.1.91008 311403.Arad_8937 gi|222082323|ref|YP_002541688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]