SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222087716|ref|YP_002546253.1| from Agrobacterium radiobacter K84

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222087716|ref|YP_002546253.1|
Domain Number 1 Region: 7-341
Classification Level Classification E-value
Superfamily SIS domain 4.33e-61
Family double-SIS domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222087716|ref|YP_002546253.1|
Sequence length 343
Comment glucosamine--fructose-6-phosphate aminotransferase [Agrobacterium radiobacter K84]
Sequence
MSDTQSLMLTEAGQSPDVVATLLEKEKPVFAEIAKLVSSTRPSLITTAARGSSDHAATFF
KYLFEISCGVPVASIGPSIASVYGTPLHLKGGIHFTVSQSGGSPDIIALQAAAKLGGATT
IAVVNVTDSPLAKEADIVLGLNAGPEKSVAATKSFIAAVAALTGVTAAISGDQALATGLA
KLPEALAATQGIDGKAAEDVLFNATSLYTGGRGPAFAIALEAALKAKETAGLHAEAFSLA
ELMHGPMRLVQPGFPIVAFSPDDAAFANNAQALERLQKLGATAVSFSTAALPGINLRMPT
TGNGLLDPLVSLLCYYRLIEAVTRRKGFDPDKPANLLKVTETM
Download sequence
Identical sequences A0A071HWG1 B9JDJ1 J2DSD3
gi|222087716|ref|YP_002546253.1| 311403.Arad_4652 WP_007692270.1.25048 WP_007692270.1.39766 WP_007692270.1.44225 WP_007692270.1.49937 WP_007692270.1.55147 WP_007692270.1.78634 WP_007692270.1.85071 WP_007692270.1.91008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]