SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222087718|ref|YP_002546255.1| from Agrobacterium radiobacter K84

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222087718|ref|YP_002546255.1|
Domain Number 1 Region: 6-208
Classification Level Classification E-value
Superfamily SIS domain 5.34e-26
Family mono-SIS domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222087718|ref|YP_002546255.1|
Sequence length 242
Comment hypothetical protein Arad_4654 [Agrobacterium radiobacter K84]
Sequence
MTAVTDSYFSALIGRLETLREALAEPMAKAARVISAAARADRRVYVFGTGHSHMLAEEVH
YRAGGLAFTIPVLVGSAMLHEGAVISSVYERTEGLIRPIFERYGMQPGDVLIIASNSGVN
AAPVEAADYGRELGTTVIAITSLAYSAVIANGRRRLADIADIVLDNGLPPGDAIIDLPGS
ELKVGPASTAIGASLLNAIFAEVAAELSKDGDPPVYLSANMPGAKETNQRLVKKYRPRNP
HL
Download sequence
Identical sequences B9JDJ3
WP_012652855.1.91008 311403.Arad_4654 gi|222087718|ref|YP_002546255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]