SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220927633|ref|YP_002504542.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220927633|ref|YP_002504542.1|
Domain Number 1 Region: 7-88
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.0000000000000196
Family Cell division protein ZapA-like 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|220927633|ref|YP_002504542.1|
Domain Number - Region: 84-117
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0157
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220927633|ref|YP_002504542.1|
Sequence length 145
Comment hypothetical protein Ccel_0174 [Clostridium cellulolyticum H10]
Sequence
MTAKNKVVIRIAGKDYTLVGSEPDEYIHKVGLYIDKKMNEIMLRNSRLSTSFAAVLTAIN
VADDYFKSKAEEISLGKEKDELVNETEKLKCEIEQLREQNEELVAKNTSLQVELAKREAE
LGEVRNSISKDNRVIAQKSLAGYDI
Download sequence
Identical sequences B8I4K8
gi|220927633|ref|YP_002504542.1| 394503.Ccel_0174 WP_012634627.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]