SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220927998|ref|YP_002504907.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220927998|ref|YP_002504907.1|
Domain Number 1 Region: 8-80
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.0000000000000589
Family Cell division protein ZapA-like 0.0043
Further Details:      
 
Weak hits

Sequence:  gi|220927998|ref|YP_002504907.1|
Domain Number - Region: 80-140
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00358
Family SNARE fusion complex 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220927998|ref|YP_002504907.1|
Sequence length 231
Comment hypothetical protein Ccel_0545 [Clostridium cellulolyticum H10]
Sequence
MTNRNKTEVYIYGSKYTISGTESEEYILKLALHVDKKMRKFAEANNALSSGMISVLAAIN
IADDYFKTLDKLQNITKNQHIETELMEKEYKQKVEELTLQIQKFKSDAVTMEEATTSQTY
ELEVIKNEFENKEKKLKQQIELLKIESGYKDEAIANQLEELENEHNQNKDELVDQIKRLK
DENTSKEKAMTELYQKMEQLKSEYKQMEELYQEEYTQLKDEYKKLEELMLK
Download sequence
Identical sequences B8I6N5
394503.Ccel_0545 WP_015924099.1.84728 gi|220927998|ref|YP_002504907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]