SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220928688|ref|YP_002505597.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928688|ref|YP_002505597.1|
Domain Number 1 Region: 219-580
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.38e-27
Family Hypothetical protein YteR 0.046
Further Details:      
 
Domain Number 2 Region: 539-662
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 0.0000314
Family Class I alpha-1;2-mannosidase, catalytic domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928688|ref|YP_002505597.1|
Sequence length 732
Comment hypothetical protein Ccel_1261 [Clostridium cellulolyticum H10]
Sequence
MKLICGDYTLIFKDGGLEVQKTGRTIYFNKRPMFVTIKTAMAINEFYNKAYSEVNIFGNS
IIAKGILTAPSGSEFSFSDVYEAGDSGFKVSRNVKVLKAGDDLGFSTKISFTMAESNDTH
DYNCFAPGVWYRQNQFAPDFAFGKDLDCEYFWQMETRYALPLFAMQNIASGETAAISRWA
SDVTMRSLDIMQSENNLDAKFTIGSIGMSRPQNKTMNYMYYGFEVRKEIETRTDGLSIDY
VYPGCDGQMPGVNHYGGLDYNGRVKTFQRINHPVEPGFEQNYSVAVNFGNYDSYQLMMRD
IWRVTYDRLRDKLFDVDNELFFHNCMNILDRYTRQYGDSYGLPFACQLPHMDINCVSFQF
GFVGQQPGIGYQLLRYGDKENIPETFEKGVNIIDFWVRTAMTESGLPNMCYNPGISTFEP
YPHYIRMLADGIEAILDAYIYMKKKGDERPKWREFCQKTADWLISNQNEDGSFYRAYNTD
GSVRMKSKSNTPSVIRFLVQFYLVTGDERYKNAAIKAGDWSYENAYLNMEYRGGTCDNTD
IQDKEAGIYAMFGFLALYDLTEEKKWLEGAVGAADYTETWTYAWKFPVRAPMEKHPFNRY
SISGQSIITIGGAADVYMAACSYTYYRLYVITGDEHYLDFAEFIHKNTRQSSDIDGSIGY
IMPGLGHESGDFTRQTLQSQYHWLPWCTFVEVDPSSRLYDTFGGYEIADAQKLSSEERIR
KNRIYANYVDSL
Download sequence
Identical sequences B8I0P2
gi|220928688|ref|YP_002505597.1| WP_015924766.1.84728 394503.Ccel_1261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]