SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220929182|ref|YP_002506091.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929182|ref|YP_002506091.1|
Domain Number 1 Region: 2-77,158-326
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.92e-66
Family Bacterial dinuclear zinc exopeptidases 0.0000085
Further Details:      
 
Domain Number 2 Region: 65-144
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.0000000000000168
Family Aminopeptidase/glucanase lid domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220929182|ref|YP_002506091.1|
Sequence length 328
Comment peptidase M42 family protein [Clostridium cellulolyticum H10]
Sequence
MQETLKTVTQAFGVSGNEEEIREIITTEIKKYVDEIKVDAMGNLIAVKKGKKKKILFAAH
MDEIGVIATFIDDNGFIRFSNLGGVSAFNSLAQRVRFQNGTIGCINVEEKLESMKTLRLG
KMYIDIGCTSKEEAEKYVKVGDTASFTGDFHVQGDYAVSKAMDDRSGCAVLIELIKTMPK
TDNEIYFVFTTQEELGLRGAKTASFGIMPDCAIAIDVTRTGDTPECNSMEVKLGKGPAIK
VKDSSYIAHPQIRRILQNLAQENGIPYTLELLDRGGSDPGAMQTSGTGIPCGGISIPCRY
VHTPCEMVSIQDLNNCVKLAGLFMKRYK
Download sequence
Identical sequences B8I2W8
394503.Ccel_1760 WP_015925226.1.84728 gi|220929182|ref|YP_002506091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]