SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220929183|ref|YP_002506092.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929183|ref|YP_002506092.1|
Domain Number 1 Region: 3-76,163-338
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.75e-65
Family Bacterial dinuclear zinc exopeptidases 0.00000739
Further Details:      
 
Domain Number 2 Region: 66-171
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.18e-23
Family Aminopeptidase/glucanase lid domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220929183|ref|YP_002506092.1|
Sequence length 348
Comment peptidase M42 family protein [Clostridium cellulolyticum H10]
Sequence
MMLIKELTDLNGVSGNENEVREYIKSKINGLCDSIEVDSIGNIIAYKKGSSGKYKVMLSA
HMDEVGFMVSGYMEKGFLKFKPVGGIDSRILPGKRVVIGKKRLKGVIGAKPLHQQSSEER
ERIAKIKDLYIDIGAETKEEAEKMAPLGEFIAFDSEYVELGKDCIKAKALDDRIGCAVLM
EVLKYNFEFDLYACFTVQEEVGLRGAQVAAFKIMPDIALVLEGTTCADVPEVKPFDFSTV
LGNGAALTLVDRTCYSDRKLVQFLYDTAVKNGIKVQYKQTTTGGNDAGQIQRTGTGVKTA
SISVPCRYIHSPVSVMSMSDFECVERLTLAALNEMNKDKDFIKNIAAV
Download sequence
Identical sequences B8I2W9
394503.Ccel_1761 gi|220929183|ref|YP_002506092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]