SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220929873|ref|YP_002506782.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929873|ref|YP_002506782.1|
Domain Number 1 Region: 37-381
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 5.62e-70
Family Homocysteine S-methyltransferase 0.0000341
Further Details:      
 
Domain Number 2 Region: 331-613
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.34e-53
Family Methylenetetrahydrofolate reductase 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220929873|ref|YP_002506782.1|
Sequence length 615
Comment bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase [Clostridium cellulolyticum H10]
Sequence
MTALSTKSIIIAMKGGLSTRLIKRKRKGKEDMNIFSNRDYFLFDGAIGTYYSLKYRSNTP
CELANINERENIFNIHSEYIQAGVNAIKTNTFSANRFSLGCNQSEVEKIIKSGYDIAVQA
CSGQEVVVFADIGPIPDEKGINPKEEYIKIVDIFLECGAKNFLFETFANTDILIGVAAYI
RLRLPEAVVVTSFAVYPDGYSKEGLFYVDLMDKMYASGLVDAVGLNCISGPAHMYRLIKK
ADIRGKSIIIMPNSGYPGSERGRTVYSDNSEYYAEKLLDLKNLGVKIFGGCCGTTPKHIA
AAAQLLSRNPTKTDAQSKTHIETCNLANENILDKLVKTKKPILVEVDPPFDTNWEYMLRD
TLLLKQAGADIITIADSPLAKARAESTIMAAKIQREAVIPVMPHITCRDKNLLGIKASLL
GVHIEGIRNVLVITGDPIANIERSRIKGVFSFNSSNLANYIKSLNSNVFCGQEIKIAGAL
NVNAVNFSAELKKAFTKIENGISCLLTQAIYTKSAVDNLLKAVETLKVPIFAGFMPIVGY
KNALFIDNEVPGIDIDNETIEKFRDKSREESEKLGMEITMDILKEIYPHVSGIYLMTPLK
RTNVICELIKKIKEI
Download sequence
Identical sequences B8I637
394503.Ccel_2474 gi|220929873|ref|YP_002506782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]