SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220927710|ref|YP_002504619.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220927710|ref|YP_002504619.1|
Domain Number 1 Region: 204-340
Classification Level Classification E-value
Superfamily CBS-domain pair 1.89e-34
Family CBS-domain pair 0.0013
Further Details:      
 
Domain Number 2 Region: 350-429
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.8e-21
Family CorC/HlyC domain-like 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220927710|ref|YP_002504619.1|
Sequence length 434
Comment hypothetical protein Ccel_0252 [Clostridium cellulolyticum H10]
Sequence
MLTKVLLLVVLVLLNAFFSGSEIALISLNDKLIKKQAEEGDKKAKQLYSFLSEPSRFLAT
IQIGITLAGFLASAFATESFVDDLTGLLVKTGFPVAESVIRSVSLVVITIILSYFTLVFG
ELIPKRLAMQKSEFLANIAVGPLMFLSRITNPFVRFLTFSTNFFIKVFGGNPAGGDDEKV
TEEEIRMMMEVGEERGVIQDTEKEMIDNIFEFDNKSVSEIMTHRTNIVGIPVDSDINYVL
YIMNRDKYTRVPIYNDNIDNIVGILHVKDLLEYTQSHNKDFSLKKIIRSAYFVPESKRTD
ELFKEMQKNKVHLAVVIDEYGGTAGIVTIEDLLEEIVGNIFDEYDIEQKDIEYLENNTYI
FDGAIDLDKVEEVLDEDLPVDDFDTLGGFILKLLGRIPKVDEKPTVPYENIVFKVVKMEG
KRIVKVQASKQENN
Download sequence
Identical sequences B8I559
394503.Ccel_0252 WP_012634704.1.84728 gi|220927710|ref|YP_002504619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]