SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220928335|ref|YP_002505244.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928335|ref|YP_002505244.1|
Domain Number 1 Region: 33-347
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.04e-88
Family Phosphate binding protein-like 0.000000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928335|ref|YP_002505244.1|
Sequence length 350
Comment family 1 extracellular solute-binding protein [Clostridium cellulolyticum H10]
Sequence
MKKIISRVLMMAATLSVSFALTGCGGASNDKITLKVFNWGDYIGEEVIQKFEDKYNINVQ
YSIFTTNEDMYVKMKAGGGDYDVVIPSDYMIKKMINEGMVKKIDLNNIPNYKYIDDKFKN
LSFDPNNEYSVPYMWGTVGIIYNKTMVKEPVDSWNILWDKKYDKQIFMLDSLRDSIGVTL
KKLGYSLNTKNKDELERAKNELIKQKDIVQAYVGDEVKDKMIMDEGAMAVVWSGDAVYMK
SQNKDLEYVIPKEGSNLWFDSMVIPSNAKHQKEAEDFINFMCETEIALENTNYIGYSTPQ
TEAKKKVAPALLKDITAYPTDEQIKNCEVFIDLDASIKDYDKIWTEITSR
Download sequence
Identical sequences B8I8N1
WP_015924424.1.84728 394503.Ccel_0892 gi|220928335|ref|YP_002505244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]