SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148546440|ref|YP_001266542.1| from Pseudomonas putida F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148546440|ref|YP_001266542.1|
Domain Number 1 Region: 428-567
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.96e-35
Family Flavohemoglobin, C-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 327-425
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 5.62e-26
Family Ferredoxin reductase FAD-binding domain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 554-666
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.11e-20
Family 2Fe-2S ferredoxin-related 0.019
Further Details:      
 
Domain Number 4 Region: 176-273
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00000027
Family PNP-oxidase like 0.021
Further Details:      
 
Weak hits

Sequence:  gi|148546440|ref|YP_001266542.1|
Domain Number - Region: 38-135
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.000982
Family PNP-oxidase like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148546440|ref|YP_001266542.1|
Sequence length 678
Comment pyridoxamine 5'-phosphate oxidase-like FMN-binding protein [Pseudomonas putida F1]
Sequence
MQQSPDHRPSPWHTGEKTLQEKVGVAERMEAFGQKVIRDHMPDQHRTFYHQLPFMVAASV
DTQGRPWATLLEGPEGFVSSPDPRMLTIHTTLPADDPATPGLAAGQAVGLLGIELHTRRR
NRINGQIRHAAQGQLQVAVEQAFGNCPQYIQLRDYTRVTEPALGRIDATTLDTSTVSMIQ
AADTFFVASYVKHADGQRSVDVSHRGGRPGFIKVEGNRLTIPDYAGNLHFNTLGNLVVNP
RAGLLFIDFNNGNVLQLYGRAEVLLDSPAIHAFEGAERLWTLQVEQVVWRPAAVALRWAF
KEYAPTSLMTGTWAEADARLEQRQQQRQWLAWRVLRVEQESRDIRSFYLEPPAGCHVAFA
PGQHLPVQVPRDGEPALIRTYSLSSAPDDGFLRISVKAQGPASRYLHEHVVAGEVLNVRP
PMGSFTLDQQSTRPLVLIGAGVGITPLLAMLRQQLRTGQARRIHLFHGARSLADLPFQQE
LATLQQQAGELLHIHRALSQPEGHAQVGRDYEFAGRLGIEQVKATLALDDYDFYLCGPGS
FTQQLYEGLRGVHVPDARIHAEAFGPSTLRRHSDADQPILQQPPAADEPVPVYFAASAKE
ARWVPGSGTLLELAEARGLAPEFSCRGGSCGTCKTRLVSGQVHYPNPPAELPEAGSVLIC
CAVPAKGEEGMQALVLDV
Download sequence
Identical sequences A5VZP8
WP_012051445.1.1079 WP_012051445.1.35996 gi|148546440|ref|YP_001266542.1| 351746.Pput_1197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]