SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134299206|ref|YP_001112702.1| from Desulfotomaculum reducens MI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134299206|ref|YP_001112702.1|
Domain Number 1 Region: 2-240
Classification Level Classification E-value
Superfamily Hsp33 domain 3.27e-76
Family Hsp33 domain 0.000000336
Further Details:      
 
Domain Number 2 Region: 231-289
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 1.57e-19
Family HSP33 redox switch-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134299206|ref|YP_001112702.1|
Sequence length 294
Comment Hsp33 protein [Desulfotomaculum reducens MI-1]
Sequence
MQDYLVRAVASDGNFRIFSARTTNTVEEARTRHNSWPVATAALGRTMTAALLMGANLKGE
DTLSIRVLGDGPLGAIIVTSNAKGEVRGYVQEPQIHLPSTPEGKLAVGAAVGKGHLHITK
DLGLKEPFTGSVELVSGEIAEDFAHYLTTSEQTPSAVSLGVLVDTDNSVVAAGGLILQLL
PGAGEEVLEILEQNLRQLPHLSSLIKNGETPEDIIKRVTKGIEMKFLESNPVGFSCQCSR
ERLENLLVGIGKDEVTSMLQEQGAAEINCHFCAENYHFDKKDLQRILKRIEEKD
Download sequence
Identical sequences A4J474
WP_011877699.1.64742 349161.Dred_1343 gi|134299206|ref|YP_001112702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]