SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134299604|ref|YP_001113100.1| from Desulfotomaculum reducens MI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134299604|ref|YP_001113100.1|
Domain Number 1 Region: 2-363
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.28e-84
Family Homocysteine S-methyltransferase 0.000019
Further Details:      
 
Domain Number 2 Region: 312-595
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.73e-61
Family Methylenetetrahydrofolate reductase 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134299604|ref|YP_001113100.1|
Sequence length 598
Comment bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase [Desulfotomaculum reducens MI-1]
Sequence
MIREYLKNNILITDGAMGTYYAQITGKYNVFPEFANINEPEIIERIHTEYINAGAKLIKT
NTFSANSRVLKIPKSEVKKIVLAGLDLANKVAQGKSIFIAASIGPIPEMFDKMETDQENS
LDEYKFIVDIFLNSDIKIFMFETFSDVSDLLEITKYIKVKDSSAFIVTQFATTPEGFTRK
GLSNKHIIAEVKKSKSIDAYGFNCGVGPTHLFNSLKKLNFADDMVAAAPNAGYPEIVHER
MVYIQNPNYFAEKMKDISGLGVKILGGCCGTTPIHIEKMSELIQSYLNAPIPKQQISAKP
KVIIDREKTDGFFEKMRKGKFVIAVELDPPFNADTDLILQNAWICKDHGVDAITIADSPM
ARARADSIMIAAKIKREVGIEVLPHLCCRDKNLNALKSALLAGYIENIRNVLAITGDPVA
IADKNDIKGVFNLNSMKLIQLISTMNKELFPEDPINVGGALNLNLLKPEAELAKMVKKIN
SGATFFLTQPIFEDYVINILRLINKNDGIKILGGIMPLVSYKNALFLNNEVAGIKIPERI
INKYNSNMGKDEAEIIGIEIAVEIANKIKESVDGFYFITPFNRVEMIMKIIKKLKCFH
Download sequence
Identical sequences A4J5C2
349161.Dred_1750 gi|134299604|ref|YP_001113100.1| WP_011878089.1.64742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]