SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134299935|ref|YP_001113431.1| from Desulfotomaculum reducens MI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134299935|ref|YP_001113431.1|
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily L28p-like 4.71e-23
Family Ribosomal protein L28 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134299935|ref|YP_001113431.1|
Sequence length 62
Comment 50S ribosomal protein L28 [Desulfotomaculum reducens MI-1]
Sequence
MAKCAICEKGVTVGIKLSHSHIRTKRTWNPNLQRVKAIVDGSPKRIMVCTRCLRSGKVQR
AI
Download sequence
Identical sequences A4J6A3
gi|134299935|ref|YP_001113431.1| 349161.Dred_2089 WP_011878412.1.64742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]