SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134300278|ref|YP_001113774.1| from Desulfotomaculum reducens MI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134300278|ref|YP_001113774.1|
Domain Number 1 Region: 178-367
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.88e-58
Family Methylesterase CheB, C-terminal domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 3-126
Classification Level Classification E-value
Superfamily CheY-like 3.56e-32
Family CheY-related 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134300278|ref|YP_001113774.1|
Sequence length 369
Comment response regulator receiver modulated CheB methylesterase [Desulfotomaculum reducens MI-1]
Sequence
MLPVKVLVVDDSSLMRRLISRLLEEDKGIKVIGTAADGLEALQQIKALRPDVVTMDVEMP
RLDGIATLRRLMVDFPTPAVMLSAHTHEGARATMDALSAGAVDFVAKPTSSAELPRMVED
LKTKVKVAARVSLRRVRTTLTPPPAPLARPKPATTAAPGSAKAKPQTQVRRQPYCGKIDL
VVIGCSTGGPAALQQIIPYLPANLPAGVVVVQHIPVGFSKSMAEHLDKKSAISVRHAAEG
DAIKAGQVLVAPAGYDLNFKAKGNGSTVALSNQGAPLAPGGFRPSVDWVMKSAAEVYGCR
TLAVLLTGMGRDGARGMLAIKEQGGPTIAEHESTCVVYGMPKAAYDIGAAGKMVPLPQIA
QEIQAFFDV
Download sequence
Identical sequences A4J796
349161.Dred_2439 WP_011878747.1.64742 gi|134300278|ref|YP_001113774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]