SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116493197|ref|YP_804932.1| from Pediococcus pentosaceus ATCC 25745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116493197|ref|YP_804932.1|
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily Formyltransferase 4.58e-57
Family Formyltransferase 0.000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116493197|ref|YP_804932.1|
Sequence length 193
Comment phosphoribosylglycinamide formyltransferase [Pediococcus pentosaceus ATCC 25745]
Sequence
MINIAVFASGTGTNFMALYQHIRETKVPIKIACLICDQPNAPVVTKADELGIPVWTHRLR
EFEDKVSYEKAILRELKKYNLALIILAGYMKIVTKVLLEAYPHAILNIHPALLPSFPGRH
GIEDAFEYGVKITGVTIHWIDGGIDTGPIIAQQPVPVLQGDDVEHLAQRIHQVEHDLYFR
SICQVLKQRKLIN
Download sequence
Identical sequences Q03E82
NYSGRC-FDAO-ABJ68490 278197.PEPE_1459 gi|116493197|ref|YP_804932.1| WP_011673676.1.1876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]