SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126464940|ref|YP_001040049.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|126464940|ref|YP_001040049.1|
Domain Number - Region: 176-259
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.00424
Family D-glucarate dehydratase-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126464940|ref|YP_001040049.1|
Sequence length 529
Comment monovalent cation/H+ antiporter subunit D [Staphylothermus marinus F1]
Sequence
MDLFRLGYDLTGLTVPVLALFAFTLPLLAKIFGHKKFPGIYALISSIFAAVSSTIIYWVA
ISTDKPIMYLFGGWIPPLGIVYEVDQFNAVIGLFTAWLMLGITIYSIWYNKHFDEPEWYY
ILLIGLNAGMLGCLYTGDVFNLFVMLEVLGISAYALVAYYKNKHEAVEAAIKYGIIGATA
TTVYFIGLVLIYGVYGTLNMADLAYRNYSLYVSGVPGLASIGASALLAVSLSLWVFTYKS
ALFPNHFWLPDAHPEAPTPVSAALSGLVVNIGVYATVRFLYTLFGEYSPLSIYYREIVLL
VLLILGFLGGFIGALMMMYQRDIKRLLAYSTISHIGLIYMAASIGFITNNEAAVLLGLTA
MTYHIITHGIGKALLFMSSGVFIDAAGTRNMDEMKGVGRKYPLVSLAFIFGFLSLMGLIP
FSGFFSKLLIYQAFMEANMIIPAIAVIIISATSILGYAKAMYSIVFSTSSREYRKIELKG
IEILLLSLAIVLLLLGILYPWIKNSIYSSIYSSLSTGGVMKYWSVLGTK
Download sequence
Identical sequences A3DKI1
399550.Smar_0028 gi|126464940|ref|YP_001040049.1| WP_011838332.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]