SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465068|ref|YP_001040177.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465068|ref|YP_001040177.1|
Domain Number 1 Region: 65-198
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 2.62e-43
Family Band 7/SPFH domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465068|ref|YP_001040177.1|
Sequence length 278
Comment hypothetical protein Smar_0156 [Staphylothermus marinus F1]
Sequence
MLPYPYIGLYFLGIEEMLPGIIFLVIILLIFLAMSIKIVREYERAVIFRLGRLLGAKGPG
LFFIIPFVDNFIKVDLRVTTVDVPEQQIITKDNVTVGVDAVVYYRVFDPVLAVTRVENYH
YAVMMMAQTTLRDIIGQVELDDLLSRREEINKRLQAILDEVTDPWGIKVTAVTLKQVRLP
ESMLRAMARQAEAERWRRAKIIEAEGEKQASIILGEAAKIYEQHPAALRLRELQTLLEIA
KEKNLIIISPSTLGAETSLLGTAIALSRKTSGSGGSGE
Download sequence
Identical sequences A3DKV9
gi|126465068|ref|YP_001040177.1| 399550.Smar_0156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]