SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465090|ref|YP_001040199.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465090|ref|YP_001040199.1|
Domain Number 1 Region: 10-123,227-423
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.09e-101
Family Substrate-binding domain of HMG-CoA reductase 0.000000185
Further Details:      
 
Domain Number 2 Region: 116-222
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 1.88e-30
Family NAD-binding domain of HMG-CoA reductase 0.000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126465090|ref|YP_001040199.1|
Sequence length 429
Comment hydroxymethylglutaryl-CoA reductase, degradative [Staphylothermus marinus F1]
Sequence
MSHETTRSSRIPGFYKKSLDERLRIVAEWTGLTEEEINLLRNLGNLPEKIADSMIENVIG
GMTYPFAVAVNFKINGKDYLVPMVIEETSVVAAASNAAKMLRRGKGIIARAGPQEMIGQI
HLVNIEAPYYKSMKILEHKEEIIDHAKQQDSTLLKLGGGPRDLEVRVLNTRIGPVIVVHL
IVDVLDAMGANAVNTMVESIAPLLEKITGGEARLRIISNYATRRIVRAWVRTDPEDVGGK
DIARKIVEASILAEADPYRAVTHNKGIMNGIIAVALATAQDHRAIEAGAHAYASRSGVYK
PLSTWELDEEEMLVGSLELPLQVGIVGGATKVHPIAKIALKILGVKTAKELAEVMAAVGL
AQNLAALRALVHEGIQKGHMRLHARNLAIMAGATGELIDKIAERMISEGRIRYDYAKKLL
EEYLKGEYK
Download sequence
Identical sequences A3DKY1
399550.Smar_0178 WP_011838482.1.69113 gi|126465090|ref|YP_001040199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]