SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465266|ref|YP_001040375.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465266|ref|YP_001040375.1|
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.62e-27
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0031
Further Details:      
 
Domain Number 2 Region: 145-253
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 0.00000000000000445
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126465266|ref|YP_001040375.1|
Sequence length 256
Comment molybdopterin dehydrogenase [Staphylothermus marinus F1]
Sequence
MIRDRRIPIPKYLVDLNAIKKELSFVEKKDDGIHIGGGTTLYELSKTFLHKDKRFAGFVD
VYKKFGTLALRFEATVAGNLVSATQYNDYITLLLVYDAKLRLVSVNGERIVKLEDFLIDK
RKVDLKPNELIYEIIFPEPPINSSSSFIKFDRRELLIAGVVTGATFLALEDNKITDVKIS
FDMVREKRIPGRARKTEEFLKGKEFSKEILEKAAEEVLPTEMERVTDWWTTAEYRMDMSK
VVLKRNLLRAYERIKG
Download sequence
Identical sequences A3DLF7
WP_011838658.1.69113 399550.Smar_0355 gi|126465266|ref|YP_001040375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]