SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465367|ref|YP_001040476.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465367|ref|YP_001040476.1|
Domain Number 1 Region: 111-386
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.77e-75
Family NadC C-terminal domain-like 0.000000191
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.79e-31
Family NadC N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126465367|ref|YP_001040476.1|
Sequence length 391
Comment nicotinate phosphoribosyltransferase [Staphylothermus marinus F1]
Sequence
MRLYVASDKEIIEGAVTDIYFVRTTRILREKGIRRKVRMEFHTTSLPKGYEWAVYAGLEE
ILYVLKDKPVTVYSLPEGTLFKPGEPLLIIEGYYDDIAVYETPLLGIMRHYTSIATKAAR
MKRLAMNKTLLFFGLRALHPALAPMADRAAYIGGLDAVSGTISEKYLGLKPVGTMPHALI
ILFGDQVKAWKAFDEVVEEDVPRIMLVDTFCDEKMESLLAAKTLGKKLYGVRLDTPSSRR
GNMRKIVEEVRWTLDINGYKHVKIIVSGGIGEKELIELRDIVDSFGIGTSIAFPKNIDIS
ADIVEIYDNGEWIPISKRGKLPGAKQLYRKRPGLNDYIGLLNRSTPPSPEYKPLLKKYID
NGKLVEKLPSIQEIRNYVLEQLKEVPEPEPV
Download sequence
Identical sequences A3DLQ8
WP_011838759.1.69113 399550.Smar_0459 gi|126465367|ref|YP_001040476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]