SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465446|ref|YP_001040555.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465446|ref|YP_001040555.1|
Domain Number 1 Region: 132-266
Classification Level Classification E-value
Superfamily Translational machinery components 5.23e-40
Family ERF1/Dom34 middle domain-like 0.00063
Further Details:      
 
Domain Number 2 Region: 4-128
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 3.66e-38
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00049
Further Details:      
 
Domain Number 3 Region: 268-361
Classification Level Classification E-value
Superfamily L30e-like 3.59e-24
Family ERF1/Dom34 C-terminal domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126465446|ref|YP_001040555.1|
Sequence length 362
Comment peptide chain release factor 1 [Staphylothermus marinus F1]
Sequence
MYVDRRQLREIIKELKKWSAPATVLLSLYIPPGRPVSDVLNMLRQELSITDNIKLKKTRS
AVQRALKAAIERLSKIPKIPDNGLALFCGEDMDTGDFICLMFVPPEKVPVYFYRTDKHFH
TEFLEEMVVESNLVGLIIIERDAATLGLLKGSRLEVLEEIEDYIPGKHHRGGQSQRRFDR
IIEQMVHDFYKRVGEHAKEKFLPLLEQGKLKAILIGGPAYSKYDFVEGDYLDYRLRQLVL
PRLIDVSYQGEVGLREMVMKASDLLKEQEYVDALKAVEEFKLNLAKDDGMIIYGEEDVKR
ALEMGAIKTLIIDEDRPDAHQWAELAKKYGAKPVFLSDDVPEGAWIKKTFGGLVGILRYR
IY
Download sequence
Identical sequences A3DLY7
WP_011838838.1.69113 gi|126465446|ref|YP_001040555.1| 399550.Smar_0540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]