SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465452|ref|YP_001040561.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465452|ref|YP_001040561.1|
Domain Number 1 Region: 37-215
Classification Level Classification E-value
Superfamily vWA-like 1.81e-30
Family Integrin A (or I) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126465452|ref|YP_001040561.1|
Sequence length 416
Comment von Willebrand factor A [Staphylothermus marinus F1]
Sequence
MEYIKASFRMGKDSVIEGREDIIPFVLSVEGVYSAHPPIAFLIVIDTSYSMDGEKIFRAK
QAALRLLDILRDKDYVGVYGFAGKFYKVLEPVPATNRNEVEKAIIGLKLGSGTNIYDTLK
KLVEETKKVLESGAISLVRIIFITDGEPTTGQKKPEKILEMAKKLREAGASALIIGVGTE
YNEKLLSRMAMVLNGEFEHVSDPASLEKLISEYAKSTQEISAKNVAVLFRLSPGFRVDIY
NRPYNNIPEGVEVEIGDIYYREIIDIVGDITTPPLLIGEAHIGEIQISYVNPETEEQEFA
TPIPIRIKVKPLEEASTVKVDEKVLAEVRMIRTATKLQETLEKRKAKDLQKELEELVETT
MRVGSEGLTAKTLNIKERIEKEGLTPETSKEMASVISRIISGRLKEEKKGEGEKNE
Download sequence
Identical sequences A3DLZ3
gi|126465452|ref|YP_001040561.1| 399550.Smar_0546 WP_011838844.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]