SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465519|ref|YP_001040628.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465519|ref|YP_001040628.1|
Domain Number 1 Region: 220-368,397-607
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.02e-112
Family Amylase, catalytic domain 0.000021
Further Details:      
 
Domain Number 2 Region: 20-86
Classification Level Classification E-value
Superfamily E set domains 0.000064
Family AMPK-beta glycogen binding domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465519|ref|YP_001040628.1|
Sequence length 696
Comment alpha amylase [Staphylothermus marinus F1]
Sequence
MYKIIGREIYGKGRKGRYIVKFTRHWPQYAKNIYLIGEFTSLYPGFVKLRKIEEQGIVYL
KLWPGEYGYGFQIDNDFENVLDPDNEEKKCVHTSFFPEYKKCLSKLVIKEPDNPLDKIIH
IEESGFIHKFNGEIIIRLIAPTEINEPLIDLGNEIREPLTKHVVGDNIVYQYIIPSRSIL
RYRFIFNYNDKKLFYGDEGVSENSSYIVVNSKYIPGVDKPRWYMGTVYYQIFIDSFDNGD
PNNDPPNRIKKTVPREYGYYGGDLAGIMKHIDHLEDLGVETIYLTPIFSSTSYHRYDTID
YKSIDKYLGTMEDFEKLVQVLHSRKIKIVLDITMHHTNPCNELFVKALREGENSPYWEMF
SFLSPPPKEIVELMLKYIDGEECRSRELYKLDYFRNNKPFYEAFFNIWLMAKFNHDNPRT
VDYFIDITKFWIDKGIDGFRIDVAMGIHYSWMKQYYEYIKNTYPDFLVLGELAENPRIYM
DYFDSAMNYYLRKAILELLIYKRIDLNEFISRINNVYAYIPHYKALSLYNMLGSHDVPRI
KSMVQNNKLLKLMYVLIFALPGSPVIYYGDEIGLEGGRDPDNRRPMIWDRGNWDLELYEH
IKKLIRIYKSCRSMRHGYFLVENLGSNLLFIKRWINNEEIIFLLNVSSKDISVDLKKLGK
YSFDIYNEKNIDQHVENNVLLRGYGFLILGSKPCNI
Download sequence
Identical sequences A3DM60
gi|126465519|ref|YP_001040628.1| 4aee_A 4aee_B 399550.Smar_0613 WP_011838911.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]