SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465570|ref|YP_001040679.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465570|ref|YP_001040679.1|
Domain Number 1 Region: 53-153
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000366
Family Multidrug resistance efflux transporter EmrE 0.023
Further Details:      
 
Domain Number 2 Region: 223-302
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000445
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126465570|ref|YP_001040679.1|
Sequence length 309
Comment hypothetical protein Smar_0665 [Staphylothermus marinus F1]
Sequence
MKFSIDNLSENSPINISRIAFYALVFTIIFLSISVASILVLLSKASAVACAFWRTFLSAI
ILWFMKLLLNRSWIGLRDYKVLSLIVLSGVFLAAHFLFWMESLFLVPVAVSTTIVVSYPL
FSLVVDKIIYNERIYRIQYIGLIMGFIGIALFMEPRLIDGYSIYGVILALLGAVAATGYF
SIGRRVRKIVDLLEYTTIAYSSAAITLLIYSLISGANLIHYGLNSYVYFFLLAIIPMLGG
HTLLNYVLKYIKTSSATSIALGEPVGASILAYIFLGQIITTIQIFLIILVLSSIILVLYP
DIRNVTEEK
Download sequence
Identical sequences A3DMB1
gi|126465570|ref|YP_001040679.1| WP_011838962.1.69113 399550.Smar_0665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]