SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465649|ref|YP_001040758.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465649|ref|YP_001040758.1|
Domain Number 1 Region: 9-273
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 2.88e-99
Family Purine and uridine phosphorylases 0.00000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126465649|ref|YP_001040758.1|
Sequence length 274
Comment 5'-methylthioadenosine phosphorylase [Staphylothermus marinus F1]
Sequence
MVLVKPPVKAEIGVIGGSGLYEIPGLQNIREYKIYTPYGMPSDNVVVGELKGRTIAFLPR
HGRGHKIPPHRVNYRANIWALKSIGVKWIIAFSAVGSLREDYKPGDFVVPDQFIDMTKGI
RPMTFFEGGVVAHVSMADPFCDHLREIIIDAAKEINGLTLHNKGTYICIEGPRFSTRAES
RVWKEVFKADIIGMTLVPEINLACEAQICYATVAMITDYDVWAEKPVTAEEVIRVMNENT
VKAKKLLPRIIEKIPEKPLEDKCSCCKSLETALV
Download sequence
Identical sequences A3DMJ0
WP_011839041.1.69113 gi|126465649|ref|YP_001040758.1| 399550.Smar_0749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]