SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465682|ref|YP_001040791.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465682|ref|YP_001040791.1|
Domain Number 1 Region: 255-612
Classification Level Classification E-value
Superfamily SIS domain 8.54e-91
Family double-SIS domain 0.00000267
Further Details:      
 
Domain Number 2 Region: 2-237
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.03e-64
Family Class II glutamine amidotransferases 0.00000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465682|ref|YP_001040791.1|
Sequence length 612
Comment glucosamine--fructose-6-phosphate aminotransferase [Staphylothermus marinus F1]
Sequence
MCGIIGVVALLGKTPYSPGVMVYRGLLRLEYRGYDSAGVASVVGGCVRVLKGKGRIADLE
RRIGLSSIEGLTVIGHTRWATHGTPSDNNAHPHIDCSGRIAVVHNGIIQNFRELKKMLID
KGHVFRSDTDTEVFPHLVEELYKNTNDLFKAFRKAVEMIDGSYALIMISSIEPDKIFFAK
KDSPLIIGLGDGFNILASDIPALLEYTRRIITVRDGWLGYVTPTSIYVEDIRGGVVDWRK
YVRVVEWSLEDATRGGYAHFMLKEIHEQPRALKDTYYGILHDIAVDETVKLMLDADKIYV
TAAGTSFHASYYFSLLMNTLGKRLVTPFIASEYESYYLTASDRDLLIVVSQSGETMDALK
ALRAFKDRGVRVVAVSNVVDSAIPRESNIAIYTRAGPEIGVAATKTFTTQSLVLSWLAIA
YAEASGSLRKSEADKLREWLGKSGEVVGKVISRSEPVAKRLAEWFRSIGNAYYLSRSIGV
PVAMEGALKLKEIAYIHAEAYPAGESKHGPIALVEEEFPVVFTIPNREDLEKLLLGNIQE
MKARGAVIIGVASENTSLSDQLDYQFKIPDTHWILTPITHIPPQQLLAYYTAVSKGYDPD
KPRNLAKTVTVE
Download sequence
Identical sequences A3DMM3
gi|126465682|ref|YP_001040791.1| 399550.Smar_0782 WP_011839074.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]