SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465723|ref|YP_001040832.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|126465723|ref|YP_001040832.1|
Domain Number - Region: 99-159
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00157
Family Biotinyl/lipoyl-carrier proteins and domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126465723|ref|YP_001040832.1|
Sequence length 172
Comment hypothetical protein Smar_0823 [Staphylothermus marinus F1]
Sequence
MEKYRYPEVFVEGVESDKYVLEINEHYILVLTKEDLEKYVNYKRVFGHIIYEHIINYIDL
VKPATKKAFIVIPEYSGEKEMNGFLIDENKKLCLIEVKGIQPYVFPREGDEIEERDKVAY
IITGKGEVRTIRSPCKGVVLLVINFPWEKPEKYVLAVVNKNDIREITIRKSP
Download sequence
Identical sequences A3DMR4
gi|126465723|ref|YP_001040832.1| 399550.Smar_0823 WP_011839115.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]