SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465811|ref|YP_001040920.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465811|ref|YP_001040920.1|
Domain Number 1 Region: 83-157
Classification Level Classification E-value
Superfamily PUA domain-like 5.25e-16
Family PUA domain 0.0031
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.000000000000575
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126465811|ref|YP_001040920.1|
Sequence length 161
Comment PUA domain-containing protein [Staphylothermus marinus F1]
Sequence
MIKRRPTVEELEELRAIADLEFRGVGEQLIPDDIVLVISPSTMKIRYLLLNNKIYLSIRA
GDYRFILHVSAGKVLNKILPHPHLRIYVNSRYSEFIASGGNVFCKHVVMADPNIKPGDEV
LVVDSDSYELLGVGRAIKPGWEITYYSWGEAVRLREGVSEE
Download sequence
Identical sequences A3DN02
399550.Smar_0913 gi|126465811|ref|YP_001040920.1| WP_011839203.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]