SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465912|ref|YP_001041021.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465912|ref|YP_001041021.1|
Domain Number 1 Region: 6-110,187-272
Classification Level Classification E-value
Superfamily alpha/beta knot 4.71e-29
Family Hypothetical protein MTH1 (MT0001), dimerisation domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126465912|ref|YP_001041021.1|
Sequence length 279
Comment hypothetical protein Smar_1015 [Staphylothermus marinus F1]
Sequence
MKTSRKILVALPTSILSTESSLLLKTIKTYQVIRYSSIFGVSEIVFFRDPFTDFSQHRKY
SVLIEKIWRYLLTPPYLRRKLIPKDPDLKFVGLLPPLRLSTFDVSRNGRVGEKRLGLIYR
EKNKLLADIGLPRPYRIEAGNCKPGDIGYVEIVDVNTRRAICLDVEPYRGPILAFADSLQ
EVLEEYRKTVDLIIATSKYGKIPSHKELAGVKGKTIIILFGGPHRGLYDIAKKEGFILEN
KVDKVWNTIPEQMVKTIRSEEALISTLAVVNMFIYGENL
Download sequence
Identical sequences A3DNA3
WP_011839304.1.69113 399550.Smar_1015 gi|126465912|ref|YP_001041021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]