SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126465982|ref|YP_001041091.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465982|ref|YP_001041091.1|
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 3.53e-16
Family Ribosomal protein L39e 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126465982|ref|YP_001041091.1|
Sequence length 51
Comment 50S ribosomal protein L39 [Staphylothermus marinus F1]
Sequence
MARNKPLARKLRLAAAYKENRPVPIWVSVKTRLKVRRGFRLRHWRRTKLKV
Download sequence
Identical sequences A3DNH3
WP_011839374.1.69113 399550.Smar_1086 gi|126465982|ref|YP_001041091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]