SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126466038|ref|YP_001041147.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|126466038|ref|YP_001041147.1|
Domain Number - Region: 42-78
Classification Level Classification E-value
Superfamily E set domains 0.00428
Family Filamin repeat (rod domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126466038|ref|YP_001041147.1|
Sequence length 87
Comment hypothetical protein Smar_1144 [Staphylothermus marinus F1]
Sequence
MEIAARDSTRIPTVKIVGVLRDPLGIPLANQELEVYINNRLYSKIKTESMGEYTVYYSPE
EPRLYEVEIRLQGNAVLKRRVKVGARG
Download sequence
Identical sequences A3DNM9
399550.Smar_1144 WP_011839430.1.69113 gi|126466038|ref|YP_001041147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]