SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126466068|ref|YP_001041177.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126466068|ref|YP_001041177.1|
Domain Number 1 Region: 83-194
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 3.01e-16
Family V-type ATPase subunit E 0.00057
Further Details:      
 
Domain Number 2 Region: 12-74
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0000105
Family F1F0 ATP synthase subunit B, membrane domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126466068|ref|YP_001041177.1|
Sequence length 195
Comment H+-transporting two-sector ATPase subunit E [Staphylothermus marinus F1]
Sequence
MNTHEVEELRQKLLEDARKKSEEIIREAEREAERIIEEAERKWREKAEQEREKIITNARL
EAQKIISEARRNYRITISKAKAEVINKILEEAKIRLTNRIGFDIEESLKKLLDEALYYIE
NPSKIIINPRDRDFIKKVLKEKGLKNIEIVESDNILGGLIIESIDGERVDNSYNTRLERA
KSIVLAELNIILWGK
Download sequence
Identical sequences A3DNQ9
WP_011839460.1.69113 399550.Smar_1174 gi|126466068|ref|YP_001041177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]