SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126466098|ref|YP_001041207.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|126466098|ref|YP_001041207.1|
Domain Number - Region: 85-216
Classification Level Classification E-value
Superfamily vWA-like 0.000667
Family Integrin A (or I) domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126466098|ref|YP_001041207.1|
Sequence length 295
Comment hypothetical protein Smar_1204 [Staphylothermus marinus F1]
Sequence
MPTRICRRASLASKLSRAHFSNLMYGVIPSRIKGPGFEYVDLREYSPGDDIRFIDWRASA
RMIKPDGDYRLMVKEHLLERLVNNIVVLDYSKSMLYGDKIESAIYVLTGFLSIAHSLGDI
IDLIILHGEKPLIKHGLNPLEAINFSLNTICKVDPSGSIDLIKLSNYVKNLRNRETLLLI
TDYAHYPIEFEVLATTTHAMNTGLGIVLVSTMLELNPPSLDGYHVFYDLEKLGSELKTMV
SEYYRAVKTHIIKTKTVLAKTRTPYIEIKGLKDAMYKKLRLLKLYSITRIRYKRY
Download sequence
Identical sequences A3DNT9
gi|126466098|ref|YP_001041207.1| 399550.Smar_1204 WP_011839490.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]