SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126466316|ref|YP_001041425.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126466316|ref|YP_001041425.1|
Domain Number 1 Region: 103-172
Classification Level Classification E-value
Superfamily Single hybrid motif 2.09e-20
Family Biotinyl/lipoyl-carrier proteins and domains 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126466316|ref|YP_001041425.1|
Sequence length 178
Comment biotin/lipoyl attachment domain-containing protein [Staphylothermus marinus F1]
Sequence
MPRRYRVETYSGDIIVAEIIDSDKQEIIVKLPGLEGEIKARIKKIVDENTILVEIDNKIY
RVYMSSDGVLIDDEVSLINRIIELIPIGLKSSYSEKKTTTITRKGEIRAPLSGKVIDIKV
KPGDKVSFGDVIALMESMKMVTEIKSDVDGIVEEVLVEKGKAVNKGTLIMRIKPLKNK
Download sequence
Identical sequences A3DPF7
399550.Smar_1427 gi|126466316|ref|YP_001041425.1| WP_011839711.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]