SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126466372|ref|YP_001041481.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|126466372|ref|YP_001041481.1|
Domain Number - Region: 69-130
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00331
Family Galactokinase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126466372|ref|YP_001041481.1|
Sequence length 139
Comment hypothetical protein Smar_1484 [Staphylothermus marinus F1]
Sequence
MSELLDLAKRMVKAFRTFECFVFEKEEIDKVRELLVQADIRSLVRIRKADPRYPYIYVVV
PWSREFENICVSRVKKMLAEGRIDRETYNKRYNEMITQCIRHYERERVKEIIEKLERYIG
KGSGGGFGGKTTIFPLEFP
Download sequence
Identical sequences A3DPL3
399550.Smar_1484 WP_011839767.1.69113 gi|126466372|ref|YP_001041481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]