SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126466473|ref|YP_001041582.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126466473|ref|YP_001041582.1|
Domain Number 1 Region: 110-181
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000111
Family PF1790-like 0.042
Further Details:      
 
Domain Number 2 Region: 51-92
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000777
Family Recombinase DNA-binding domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126466473|ref|YP_001041582.1|
Sequence length 240
Comment hypothetical protein Smar_1590 [Staphylothermus marinus F1]
Sequence
MIISRKPGPEEERLIIEMYKKYGKVIVIAKTLHHDPKIIRRILVKHGIKLPSQRSKELRE
KIVSLYKQGLSGKQISKMLGINYQTVLYHLHKAGFKSERIFVKNKLMAKKRKQLMKELLE
SKGPMLVTDLIRILNISYSSIISYIRDIDAEKIVFTNKTPRGRPKYYKYYKDKLRRLWRY
HIVSLKHDPRLYEFIAKIIVENNLVPEDRYERSILTRMLRHTGLTEEEVSRIYMHIETMK
Download sequence
Identical sequences A3DPW4
399550.Smar_1590 WP_011839868.1.69113 gi|126466473|ref|YP_001041582.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]